Chromohalobacter japonicus

Author: gctf

August undefined, 2024

WebThe proteobacterium Chromohalobacter salexigens can endure some of the widest reported salinity ranges ... 2002) or by L-lysine α-oxidase from Scomber japonicus and … Webchildren Name: Chromohalobacter salexigens Arahal et al. 2001 Category: Species Proposed as: sp. nov. Etymology: sal.ex’i.gens. L. masc. n. sal, salt; L. v. exigo, to demand; N.L. part. adj. salexigens, salt-demanding Gender: masculine Type strain: ATCC BAA-138; CCM 4921; CECT 5384; CIP 106854; DSM 3043; NCIMB 13768

Chromobacterium - Wikipedia

Web48.2.1 Alpha-Amylases. Alpha-amylases belong to the family of endo -amylases and act on starch to yield glucose and maltose. The first starch-degrading enzyme was discovered … WebLactobacillus japonicus Lactobacillus jensenii Lactobacillus jensenii 115-3-CHN Lactobacillus jensenii 1153 Lactobacillus jensenii 208-1 Lactobacillus jensenii 269-3 Lactobacillus jensenii 27-2-CHN Lactobacillus jensenii DSM 20557 Lactobacillus jensenii EX533959VC02 Lactobacillus ... in which year did kepler publish his 1st law

Chromohalobacter - Wikipedia

WebChromohalobacter japonicus Taxonomy - PubChem taxonomy Summary Chromohalobacter japonicus Cite Download Contents 1 Names and Identifiers 2 … WebPhylum: Proteobacteria. Classis: Gammaproteobacteria. Ordo: Oceanospirillales. Familia: Halomonadaceae. Genus: Chromohalobacter. Species: Chromohalobacter marismortui – Chromohalobacter sp. – Chromohalobacter beijerinckii – Chromohalobacter nigrandesensis – Chromohalobacter canadensis – Chromohalobacter israelensis ... WebSep 16, 2024 · T. halophilus, sequencing provided an overview of the microbiota including non-cultured bacteria. The volatile compounds were determined by gas chromatography–mass spectrometry (GC–MS). in which year did mcfly rise to fame

Halomonas stevensii sp. nov., Halomonas hamiltonii sp. nov. and ...

Chromohalobacter beijerinckii - Wikipedia

Chromohalobacter is a gram negative, oxidase and catalase positive, rod shaped, motile marine Pseudomonadota. It is commonly found in marine environments. Two species of Chromohalobacter (Chromohalobacter marismortui and Chromohalobacter salexigens) was isolated from marine sponges of the Saint Martin's Island area of the Bay of Bengal, Bangladesh. WebFeb 12, 2024 · A search in the GenBank database identified benA genes in only two strains of the genus Chromohalobacter: a gene encoding the α‑subunit of benzoate 1,2-DO (EU155151) in Chromohalobacter sp. HS-2 and genes of the α-subunit of benzoate 1,2-DO and benzoate-toluate 1,2-DO (QGTY01000032 and QGTY01000001) in C. salexigens … on off on switch 120vWebSep 14, 2024 · The EstSHJ2 was the first reported esterase from Chromohalobacter canadensis, and may carry considerable potential for industrial applications under extreme conditions. ... Chromohalobacter japonicus (MF769788 and OLO11728.1), Halomonas elongata (CBV41603.2), Halomonas caseinilytica (SHK36670.1), Halomonas … in which year did the beatles split up

"WebThe name Chromohalobacter japonicus sp. nov. is proposed, with strain 43T (5CECT 7219T 5CCM 7416T) as the type strain. The family Halomonadaceae includes the genera reclassification of Pseudomonas … " - Chromohalobacter japonicus

Chromohalobacter japonicus

Chromohalobacter beijerinckii - Wikipedia

WebChromohalobacter Click on organism name to get more information. Chromohalobacter beijerinckii Chromohalobacter canadensis Chromohalobacter israelensis Chromohalobacter japonicus Chromohalobacter marismortui Chromohalobacter nigrandesensis Chromohalobacter salexigens Chromohalobacter salexigens DSM 3043 WebOverall, the phenotypic, genotypic and phylogenetic results demonstrated that strain 43(T) represents a novel species within the genus Chromohalobacter. The name …

Did you know?

WebChromohalobacter japonicus sp. nov., a moderately halophilic bacterium isolated from a Japanese salty food. A Gram-negative, non-spore-forming, rod-shaped, motile … WebChromohalobacter japonicus 43 is an aerobe, mesophilic, Gram-negative bacterium that was isolated from food product. Gram-negative. motile. rod-shaped. aerobe. mesophilic. …

WebProduksi dan Optimasi Biosurfaktan dari Bakteri Halofilik Chromohalobacter japonicus BK-AB18. 2(2), 1–19. Diyan Arini, Arneli, A. S. (2008). Pengaruh Penambahan Karboksimetil Selulosa dan Buffer pada Detergensi Surfaktan asil Sublasi Limbah Cair Cucian. 11(3), 78–83. WebNov 2, 2024 · The fruit extracts of C. japonica (CJ) have been reported to have anticancer activity 22, cardiovascular protection effect 23, and gastroprotective effect via …

WebChromohalobacter moromii sp. nov., a moderately halophilic bacterium isolated from lupine-based moromi fermentation Syst Appl Microbiol. 2024 Apr 26;45 (4):126324. doi: 10.1016/j.syapm.2024.126324. Online ahead of print. Authors Rebekka H Lülf 1 , Maik Hilgarth 2 , Matthias A Ehrmann 3 Affiliations Webcurrent name Chromohalobacter japonicus Sanchez-Porro et al. 2007 type strain of Chromohalobacter japonicus: CCM :7416, CECT :7219, personal::43 includes: …

WebDec 1, 2024 · It revealed that mostly Tetragenococcus (80.9%) and Halomonadaceae (15.3%) were present in brine A ( Fig. 1 A). In brine C, Tetragenococcus (60.1%) and Halomonadaceae (19.2%) were present too, next to Halanaerobium (17.7%), Chromohalobacter (1.2%), which belongs to the Halomonadaceae family, and …

WebGenus Chromohalobacter. Etymology: Chro.mo.ha.lo.bac.ter. Gr. neut. n. chrôma, color; Gr. masc. n. hals (gen. halos), salt; N.L. masc. n. bacter, rod; N.L. masc. n. … onoffon官网旗舰店Web>CAPGI00980 C2M4T5 OMAGroup:1132072 [Capnocytophaga gingivalis] MKKIGKNLEIKNIIIHQLLKEAGNGIVDAKSADHVLNISDREKLFLGNLDEAYYKKSEIIHGIFSGNFPKFKDLLLEYTE ... in which year did the minicomputer appearWebJul 1, 2024 · However, average nucleotide highest identity values of TMW 2.2308 T to C. beijerinckii LMG 2148 T of 93.12% and 92.88% to C. japonicus CECT 7219 T demonstrate that it represents a novel species within the genus Chromohalobacter with additional strains TMW 2.2299 (96.91%) and TMW 2.2304 (96.98%). onoff on webWebDec 1, 2009 · Chromohalobacter japonicus sp. nov., a moderately halophilic bacterium isolated from a Japanese salty food. Int J Syst Evol Microbiol 57, 2262 –2266. [Google Scholar] Sasser, M. (1990). ... Chromohalobacter Ventosa, Gutierrez, García and Ruiz-Berraquero 1989, 384 VP emend. Arahal, García, Ludwig, Schleifer and Ventosa 2001a, … in which year did sandy lyle win the mastersWebJul 3, 2024 · Two isolates assigned to group II showed a high similarity of 99.93% to Chromohalobacter japonicus CECT 7219 T. In addition, one isolate belonging to group III and another to group IV showed high similarity of 99.06 and 99.33% to Halomonas garicola JCM 30151 T and Staphylococcus equorum DSM 20674 T, respectively. on off open closeWebOct 1, 2007 · Chromohalobacter japonicus gene for 16S ribosomal RNA, partial sequence. (ENA - AB105159) Chromohalobacter japonicus partial 16S ribosomal RNA (ENA - AB105159.21..1501:rRNA) Similar Articles . To arrive at the top five similar articles we use a word-weighted algorithm to compare words from the Title and Abstract of each … onoff outletWebName: Chromohalobacter japonicus Sánchez-Porro et al. 2007 Category: Species Proposed as: sp. nov. Etymology: ja.po’ni.cus. N.L. masc. adj. japonicus, Japanese … in which year did steve jobs die